PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400042629
Common NameLOC102583048
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28727.4 Da    PI: 9.5353
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400042629genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.16.4e-30959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +i+fs++gkl+eys+
  PGSC0003DMP400042629  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYST 59
                          79***********************************************96 PP

2K-box98.97.2e-33801756100
                 K-box   6 gks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                            ++ ++ ++  s++ e+akLk+++e Lqr+q+h+ Ge+L++Ls+ke q+Le+qL+++lk+iRs+Kn+l++e+i+ lqkk k+lqe+n++
  PGSC0003DMP400042629  80 LNAaTDIETPGSWTLEHAKLKARLEVLQRNQKHYAGEELNTLSMKEFQNLEHQLDSALKHIRSRKNQLMHESISALQKKDKALQEQNNN 168
                           555455667789***************************************************************************** PP

                 K-box  94 Lrkklee 100
                           L+k+++e
  PGSC0003DMP400042629 169 LSKQVKE 175
                           ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.184161IPR002100Transcription factor, MADS-box
CDDcd002657.17E-42279No hitNo description
SuperFamilySSF554553.4E-33282IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-31323IPR002100Transcription factor, MADS-box
PfamPF003196.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.41189179IPR002487Transcription factor, K-box
PfamPF014868.0E-2791173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVGLIVFST KGKLFEYSTD  60
SCMERILERY ERYSYAERQL NAATDIETPG SWTLEHAKLK ARLEVLQRNQ KHYAGEELNT  120
LSMKEFQNLE HQLDSALKHI RSRKNQLMHE SISALQKKDK ALQEQNNNLS KQVKEREKEM  180
SQQTPWEQQS HDHLNSSSFV LPHPFNNLHM GEAYPTAGDN GEVEGSSRQQ QQNTSSVMPP  240
WMLRHLNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S5e-22174173Myocyte-specific enhancer factor 2B
1tqe_R5e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q5e-22174173Myocyte-specific enhancer factor 2B
1tqe_P5e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0140570.0BT014057.1 Lycopersicon esculentum clone 133155F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345101.10.0PREDICTED: agamous-like MADS-box protein AGL8 homolog
SwissprotQ424291e-141AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLM1CAG60.0M1CAG6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000633130.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-105AGAMOUS-like 8
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]